html текст
All interests
  • All interests
  • Design
  • Food
  • Gadgets
  • Humor
  • News
  • Photo
  • Travel
  • Video
Click to see the next recommended page
Like it
Don't like
Add to Favorites

В объективе. Полеталки

Футболисты — не совсем обычные люди. Живут по-другому, питаются по особым рецептам… А тут еще появились подозрения, что они летать умеют. Новая фотоподборка FootballTop.ru предлагает лучшие кадры прошедших выходных. Приятного просмотра!

atleticodemadridvrealmadridlaligakv6ybwbo2sdl.jpg

Пепе уже не тот. Почему все соперники вокруг него все еще на стоят на ногах?

atleticodemadridvrealmadridlaligapuvnrduvkokl.jpg

А вот Фалькао все тот же. Прыгает высоко, летает почти, голы «Реалу» забивает, но все так же без толку. «Атлеты» снова пролетели проиграли в дерби.

fcbarcelonavathleticbilbaolaligaicsluum-2bll.jpg

Месси снова вышел и забил. Что тут особенного? Да ничего. Проблема в том, что он буквально вышел, дошел (не добежал) до штрафной, обошел (не оббежал!) четырех соперников и забил. Пешком уже забивает. Скоро, видно, взглядом закидывать будет.

torinofcvjuventusseriea38dyy4d4lyul.jpg

Антонио Конте и Артуро Видаль круче Фалькао. Они тоже летают, только вместе. И это так мило…

torinofcvjuventusserieagi4py24e0ynl.jpg

За афишным блеском дерби мадридского все забыли про дерби туринское. «Юве» в нем выиграл, что привело ноги некоторых «бьянконери» в весьма странное положение в пространстве.

cittadipalermovfcinternazionalemilanoiwkyqq19sy1l.jpg

Вы никогда не задумывались, как выглядит Эдгар Давидс без очков? А злой Эдгар Давидс? Может, так?

cittadipalermovfcinternazionalemilanob8_f4xcvicil.jpg

«Я не могу понять только одного: почему я ничего не понимаю?»

chelseavswanseacitypremierleaguek8wg6xoiyh6l.jpg

Никогда не сдавайся!

wiganathleticvtottenhamhotspurpremier0r-sglkj68ol.jpg

Пепе, смотри как надо! (см. первое фото)

chelseavswanseacitypremierleaguedjjkb9pndcxl.jpg

Давид Луис тоже высоко прыгает, тоже почти летает. Жульничает, правда, но высоко.

manchestercityvwesthamunitedpremier0q2t73p5ikul.jpg

Уж не скриншот ли это из новой версии FIFA?

manchestercityvwesthamunitedpremierzigchlft3k2l.jpg

«Думаете, что я падаю? Нет, я так летаю! Как умею, так и летаю…»

newcastleunitedvliverpoolpremierleague3klgcx-d0ivl.jpg
newcastleunitedvliverpoolpremierleaguevdxitmwzfbbl.jpg

Под суровым взором Роя Ходжсона с трибуны «Ливерпуль» показательно разделался в «французским» «Ньюкаслом»… К чему бы это?

arsenalvmanchesterunitedpremierleaguen_fxlf6vnf5l.jpg

Он честно бил по чему-то круглому.

arsenalvmanchesterunitedpremierleagueoow6jxupmqxl.jpg

Робин ван Перси забивает Войцеху Щенсному. Отрабатывали ведь на тренировках!

wiganathleticvtottenhamhotspurpremierz8jddhjwrnfl.jpg

«Ты сюда не снимай, ты туда снимай!»

Фото: Shaun Botterill, Mike Hewitt, Gareth Copley, Richard Heathcote, Alex Livesey, Valerio Pennicino, Tullio M. Puglia, Claudio Villa, Gonzalo Arroyo Moreno, Denis Doyle / getty images, zimbio.com

Читать дальше
Twitter
Одноклассники
Мой Мир

материал с footballtop.ru

4

      Add

      You can create thematic collections and keep, for instance, all recipes in one place so you will never lose them.

      No images found
      Previous Next 0 / 0
      500
      • Advertisement
      • Animals
      • Architecture
      • Art
      • Auto
      • Aviation
      • Books
      • Cartoons
      • Celebrities
      • Children
      • Culture
      • Design
      • Economics
      • Education
      • Entertainment
      • Fashion
      • Fitness
      • Food
      • Gadgets
      • Games
      • Health
      • History
      • Hobby
      • Humor
      • Interior
      • Moto
      • Movies
      • Music
      • Nature
      • News
      • Photo
      • Pictures
      • Politics
      • Psychology
      • Science
      • Society
      • Sport
      • Technology
      • Travel
      • Video
      • Weapons
      • Web
      • Work
        Submit
        Valid formats are JPG, PNG, GIF.
        Not more than 5 Мb, please.
        30
        surfingbird.ru/site/
        RSS format guidelines
        500
        • Advertisement
        • Animals
        • Architecture
        • Art
        • Auto
        • Aviation
        • Books
        • Cartoons
        • Celebrities
        • Children
        • Culture
        • Design
        • Economics
        • Education
        • Entertainment
        • Fashion
        • Fitness
        • Food
        • Gadgets
        • Games
        • Health
        • History
        • Hobby
        • Humor
        • Interior
        • Moto
        • Movies
        • Music
        • Nature
        • News
        • Photo
        • Pictures
        • Politics
        • Psychology
        • Science
        • Society
        • Sport
        • Technology
        • Travel
        • Video
        • Weapons
        • Web
        • Work

          Submit

          Thank you! Wait for moderation.

          Тебе это не нравится?

          You can block the domain, tag, user or channel, and we'll stop recommend it to you. You can always unblock them in your settings.

          • id173705026
          • домен footballtop.ru

          Get a link

          Спасибо, твоя жалоба принята.

          Log on to Surfingbird

          Recover
          Sign up

          or

          Welcome to Surfingbird.com!

          You'll find thousands of interesting pages, photos, and videos inside.
          Join!

          • Personal
            recommendations

          • Stash
            interesting and useful stuff

          • Anywhere,
            anytime

          Do we already know you? Login or restore the password.

          Close

          Add to collection

             

            Facebook

            Ваш профиль на рассмотрении, обновите страницу через несколько секунд

            Facebook

            К сожалению, вы не попадаете под условия акции